GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI
TAT-DEF-Elk-1
Catalog:CDCCP23-027L
Synonym | TDE |
Common Use | TAT-DEF-Elk-1 (TDE) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity |
Structure | |
Purity | ≥99% |
Storage | Powder: -80 °C, 2 years; -20 °C, 1 year. In solvent: -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Molecular Weight | 3561.07 |
Molecular Formula | C155H259N57O40 |
CAS No. | 1220751-16-5 |
Appearance | Solid |
Solubility | Soluble in water |
Catalog: CDCCP23-001L
Catalog: CDCCP23-122L
Catalog: CDCCP23-116L
Catalog: CDCCP23-018L
Catalog: CDCCP23-061L
Catalog: CDCCP23-145L
Catalog: CDCCP23-066L
Catalog: CDCCP23-070L
1. Download the template.
2. Enter product information on the template (maximum number of products: 200).
3. Load the file using selector below.
1. Download the template.
2. Enter product information on the template (maximum number of products: 200).
3. Load the file using selector below.